PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_931_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 88aa    MW: 10087.7 Da    PI: 10.0412
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_931_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.7e-191461148
                                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                       +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
  cra_locus_931_iso_5_len_862_ver_3 14 KGPWTPEEDQKLLAYIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNYL 61
                                       79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-27564IPR009057Homeodomain-like
PROSITE profilePS5129424.152965IPR017930Myb domain
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002498.2E-181461IPR001005SANT/Myb domain
SuperFamilySSF466891.48E-241588IPR009057Homeodomain-like
CDDcd001674.84E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.9E-86588IPR009057Homeodomain-like
PROSITE profilePS512947.5696688IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010091Biological Processtrichome branching
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE EHGHGSWRAL PSKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-161288580B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004489411.14e-61PREDICTED: transcription factor MYB34
SwissprotQ7XBH44e-48MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLK4BBX57e-60K4BBX5_SOLLC; Uncharacterized protein
STRINGSolyc02g088190.2.12e-59(Solanum lycopersicum)